Skip to product information
1 of 1

Gene Bio Systems

Recombinant Methanoregula boonei UPF0059 membrane protein Mboo_0607 (Mboo_0607)

Recombinant Methanoregula boonei UPF0059 membrane protein Mboo_0607 (Mboo_0607)

SKU:CSB-CF414987MNV

Regular price €1.461,95 EUR
Regular price Sale price €1.461,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Methanoregula boonei (strain 6A8)

Uniprot NO.:A7I5W4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDLLTSSLIGIGLSMDCFAVALAIGTSERLPLVRSALVIAASFGIFQAGMTIAGWIAGAS LYTEISSYGSWIAFLLLAGIGIKMIYDGIREEHEPTLSGLHAIPVILLSLATSIDAFAAG VSFGVLGSTVLMPALAIGLVCFVVSCAGVFCGMRLEKLLGNRTEIFGGVILILIGIQILT DILPL

Protein Names:Recommended name: UPF0059 membrane protein Mboo_0607

Gene Names:Ordered Locus Names:Mboo_0607

Expression Region:1-185

Sequence Info:full length protein

View full details