Skip to product information
1 of 1

Gene Bio Systems

Recombinant Methanococcus maripaludis UPF0333 protein MMP0903(MMP0903)

Recombinant Methanococcus maripaludis UPF0333 protein MMP0903(MMP0903)

SKU:CSB-CF740457MSB

Regular price €1.356,95 EUR
Regular price Sale price €1.356,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Methanococcus maripaludis (strain S2 / LL)

Uniprot NO.:Q6LYT4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGLKYLAFKNRGQISLELGVLVLAVAMVAVFAGYLYIQSTLESAVKINQTANGTVGMYNS AVNRITESVGNLSNN

Protein Names:Recommended name: UPF0333 protein MMP0903

Gene Names:Ordered Locus Names:MMP0903

Expression Region:1-75

Sequence Info:full length protein

View full details