Gene Bio Systems
Recombinant Methanococcus maripaludis UPF0290 protein MmarC5_1708 (MmarC5_1708)
Recombinant Methanococcus maripaludis UPF0290 protein MmarC5_1708 (MmarC5_1708)
SKU:CSB-CF389507MNP
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Methanococcus maripaludis (strain C5 / ATCC BAA-1333)
Uniprot NO.:A4G0M1
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MDLLLLLFSAIWYILPAYIANAVPCILGGGRPVDFGKNFFDGYRLIGNGVTYRGTFFGIL FGIITGILQHFIVILYMDPESAFNYGLSGYIILSFLLATGALFGDMLGSFIKRRFKLNQG QSAPLLDQITFIVFALLFAYPFYPLPINTIILLLVISPLIHLSSNIVAYKLHLKKVWW
Protein Names:Recommended name: UPF0290 protein MmarC5_1708
Gene Names:Ordered Locus Names:MmarC5_1708
Expression Region:1-178
Sequence Info:full length protein
