Skip to product information
1 of 1

Gene Bio Systems

Recombinant Methanococcoides burtonii UPF0290 protein Mbur_1051(Mbur_1051)

Recombinant Methanococcoides burtonii UPF0290 protein Mbur_1051(Mbur_1051)

SKU:CSB-CF623765MRY

Regular price €1.461,95 EUR
Regular price Sale price €1.461,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Methanococcoides burtonii (strain DSM 6242)

Uniprot NO.:Q12X42

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLPAYLPNPFAALFGGGRPIDNGKTMSDGRRILGDGKTYRGFFVGLIFGALAGLMQMQLL EKYPVLFGVELPTFGTGGSNTTILIFALAVGSLFGDMFMSFFKRRMGLKRGAPLPVIDQL DFVLGALIFAYLASPVWFAEQFTFKVIAVILIITPLLHLATNVVGYFIGVKKEPW

Protein Names:Recommended name: UPF0290 protein Mbur_1051

Gene Names:Ordered Locus Names:Mbur_1051

Expression Region:1-175

Sequence Info:full length protein

View full details