Skip to product information
1 of 1

Gene Bio Systems

Recombinant Methanocaldococcus jannaschii Molybdate-tungstate transport system permease protein wtpB(wtpB)

Recombinant Methanocaldococcus jannaschii Molybdate-tungstate transport system permease protein wtpB(wtpB)

SKU:CSB-CF704452MRU

Regular price €1.524,95 EUR
Regular price Sale price €1.524,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Uniprot NO.:Q58763

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEKFDIAMTVFLVMIFLFIFLPIIYMLSNPGDLNQLLDKEVIEAFKTTLLAGAVATLIAL IFGIPTGYILARYDFKFKSFVEAVLDLPMAIPHSVIGIIILSFIYGIDIINFIGRYVVDN FWGIVTVYLFVGIPFMVNSIRDGFLSVDEEIEYVSRTLGASKIRTFFEISLPLIKNNIIS GIILSFARGISEVGAILIIAYYPKTVPILIYERFMSFGLDASKPISVGMILISIALFALL RMFGRMRGR

Protein Names:Recommended name: Molybdate/tungstate transport system permease protein wtpB

Gene Names:Name:wtpB Ordered Locus Names:MJ1368

Expression Region:1-249

Sequence Info:full length protein

View full details