Gene Bio Systems
Recombinant Meriones unguiculatus Monocarboxylate transporter 1(SLC16A1)
Recombinant Meriones unguiculatus Monocarboxylate transporter 1(SLC16A1)
SKU:CSB-CF021403MRA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Meriones unguiculatus (Mongolian jird) (Mongolian gerbil)
Uniprot NO.:O35439
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:LSILAFVDMVARPSMGLAANTKWIRPRIQYFFAASVVANGVCHLLAPLSTSYIGFCVYAG VFGFAFGWLSSVLFET
Protein Names:Recommended name: Monocarboxylate transporter 1 Short name= MCT 1 Alternative name(s): Solute carrier family 16 member 1
Gene Names:Name:SLC16A1 Synonyms:MCT1
Expression Region:1-76
Sequence Info:full length protein
