Skip to product information
1 of 1

Gene Bio Systems

Recombinant Meleagrid herpesvirus 1 Envelope protein UL45 homolog

Recombinant Meleagrid herpesvirus 1 Envelope protein UL45 homolog

SKU:CSB-CF323024MDM

Regular price €1.496,95 EUR
Regular price Sale price €1.496,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Meleagrid herpesvirus 1 (strain H2) (MeHV-1) (Turkey herpesvirus)

Uniprot NO.:P18536

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MMSPTPEDDRDLVVVRGRLRMMDSGTETDREQRHPRTTWRSICCGCTIGMVFTIFVLVAA VLLGSLFTVSYMAMESGTCPDEWIGLGYSCMRVAGKNATDLEALDTCARHNSKLIDFANA KVLVEAIAPFGVPNAAYGEVFRLRDSKTTCIRPTMGGPVSADCPVTCTVICQRPRPLSTM SSIIRDARVYLHLERRDYYEVYASVLSNAMSK

Protein Names:Recommended name: Envelope protein UL45 homolog Alternative name(s): 23.5 kDa protein

Gene Names:

Expression Region:1-212

Sequence Info:full length protein

View full details