Skip to product information
1 of 1

Gene Bio Systems

Recombinant Mannheimia succiniciproducens UPF0299 membrane protein MS1271(MS1271)

Recombinant Mannheimia succiniciproducens UPF0299 membrane protein MS1271(MS1271)

SKU:CSB-CF727551MAAB

Regular price €1.426,95 EUR
Regular price Sale price €1.426,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mannheimia succiniciproducens (strain MBEL55E)

Uniprot NO.:Q65T32

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MRQKIFLFVRSLIILYLILFIGEGIAKLIPIGIPGSIFGLLILFIGLTTQIIKVDWVFFG ASLLIRYMAVLFVPVSVGVMKYSDLLVSHASSLLIPNIVSTCVTLLVIGFLGDYLFSLNS FTRLRKKAIKKRDINNVNNKGEAS

Protein Names:Recommended name: UPF0299 membrane protein MS1271

Gene Names:Ordered Locus Names:MS1271

Expression Region:1-144

Sequence Info:full length protein

View full details