Skip to product information
1 of 1

Gene Bio Systems

Recombinant Malaria protein EXP-1(EXP-1)

Recombinant Malaria protein EXP-1(EXP-1)

SKU:CSB-CF361413PLO

Regular price €1.422,95 EUR
Regular price Sale price €1.422,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Plasmodium falciparum

Uniprot NO.:P04926

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:EKTNKETGSGVSSKKKNKKGSGEPLIDVHDLISDMIKKEEELVEVNKRKSKYKLATSVLA GLLGVVSTVLLGGVGLVLYNTEKGRHPFKIGSSDPADNANPDADSESNGEPNADPQVTAQ DVTPEQPQGDDNNLVSGPEH

Protein Names:Recommended name: Malaria protein EXP-1 Alternative name(s): Exported antigen AG 5.1

Gene Names:Name:EXP-1

Expression Region:23-162

Sequence Info:full length protein

View full details