Skip to product information
1 of 1

Gene Bio Systems

Recombinant Magnaporthe oryzae Golgi apparatus membrane protein TVP23(TVP23)

Recombinant Magnaporthe oryzae Golgi apparatus membrane protein TVP23(TVP23)

SKU:CSB-CF393489MPM

Regular price €1.482,95 EUR
Regular price Sale price €1.482,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) (Rice blast fungus) (Pyricularia oryzae)

Uniprot NO.:A4RME3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MMEAQQQPSAGSLSWRLSSHPITLLTFLAFRVSSLLVYLFGLIFIDNMVMIFIITILLLA ADFYYLKNIAGRRLVGLRWWNEVDPQSGDSHWVFESSEPGTKTVNPTDSRFFWLAIYAQP LLWIGLAVLALVRLKFIWLPLVAIALVLTITNSLAFSRCDKFSQASNLAGSAFSTGNLAG SIATGLVGRLFSRS

Protein Names:Recommended name: Golgi apparatus membrane protein TVP23

Gene Names:Name:TVP23 ORF Names:MGG_04806

Expression Region:1-194

Sequence Info:full length protein

View full details