Skip to product information
1 of 1

Gene Bio Systems

Recombinant Macaca mulatta (Rhesus macaque) Platelet-activating factor receptor(PTAFR)

Recombinant Macaca mulatta (Rhesus macaque) Platelet-activating factor receptor(PTAFR)

SKU:CSB-CF018946MOW

Regular price €1.491,95 EUR
Regular price Sale price €1.491,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Macaca mulatta (Rhesus macaque)

Uniprot NO.:P35366

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEPHDSSHVDSEFRYTLFPIVYSIIFVLGVIANGYVLWVFARLYPSKKFNEIKIFMVNLT MADMLFLITLPLWIVYYQNGGNWIFPKFLCNLAGCLFFINTYCSVAFLGVITYNRFQAVT RPIKTAQANTRKRGISLSLVIWVAIVGAASYFFILDSTNTVPNSAGSGNITRCFEHYEKG SVPVLIIHIFIVFSFFLVFLIILFCNLV

Protein Names:Recommended name: Platelet-activating factor receptor Short name= PAF-R Short name= PAFr

Gene Names:Name:PTAFR

Expression Region:1-208

Sequence Info:Full length protein

View full details