Skip to product information
1 of 1

Gene Bio Systems

Recombinant Macaca mulatta (Rhesus macaque) Arachidonate 5-lipoxygenase-activating protein(ALOX5AP)

Recombinant Macaca mulatta (Rhesus macaque) Arachidonate 5-lipoxygenase-activating protein(ALOX5AP)

SKU:CSB-CF001625MOW

Regular price €1.435,95 EUR
Regular price Sale price €1.435,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Macaca mulatta (Rhesus macaque)

Uniprot NO.:P30354

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNC VDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLLVRQKYFVGYLGERTQSTPGYIFGKRIIL FLFLMSVAGIFNYYLIFFFGSDFENYIKTVTTT

Protein Names:Recommended name: Arachidonate 5-lipoxygenase-activating protein Alternative name(s): FLAP MK-886-binding protein

Gene Names:Name:ALOX5AP Synonyms:FLAP

Expression Region:1-153

Sequence Info:Full length protein

View full details