Skip to product information
1 of 1

GeneBio Systems

Recombinant Macaca fascicularis Myoglobin (MB)

Recombinant Macaca fascicularis Myoglobin (MB)

SKU:P02150

Regular price €847,95 EUR
Regular price Sale price €847,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: P02150

Gene Names: MB

Alternative Name(s):

Abbreviation: Recombinant Cynomolgus monkey Myoglobin protein

Organism: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Source: E.coli

Expression Region: 2-154aa

Protein Length: Full Length of Mature Protein

Tag Info: C-terminal 6xHis-tagged

Target Protein Sequence: GLSDGEWQLVLNVWGKVEADIPSHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGVTVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLELISESIIQVLQSKHPGDFGADAQGAMNKALELFRNDMAAKYKELGFQG

MW: 23.9 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Serves as a reserve supply of oxygen and facilitates the movement of oxygen within muscles.

Reference: "The myoglobin of primates. 3. Cercopithecidae (Old World monkeys): Papio anubis (olive baboon) and Macaca fascicularis (=irus, crab-eating monkey)." Romero-Herrera A.E., Lehmann H. Biochim. Biophys. Acta 278: 465-481(1972)

Function:

View full details