Recombinant Lolium perenne Major pollen allergen Lol p 5a(LOLPIB)

SKU: CSB-EP670318LQK

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Allergen

Uniprot ID: Q40240

Gene Names: LOLPIB

Organism: Lolium perenne

AA Sequence: ADAGYTPAAAATPATPAATPAAAGGKATTDEQKLLEDVNAGFKAAVAAAANAPPADKFKIFEAAFSESSKGLLATSAAKAPGLIPKLDTAYDVAYKAAEATPEAKYDAFVTALTEALRVIAGALEVHAVKPATEEVLAAKIPTGELQIVDKIDAAFKIAATAANAAPTNDKFTVFESAFNKALNECTGGAYETYKFIPSLEAAVKQAYAATVAAAPEVKYAVFEAALTKAITAMTQAQKAGKPAAAAATAAATVATAAATAAAVLPPPLLVVQSLISLLIYY

Expression Region: 26-307aa

Sequence Info: Full Length of Mature Protein

Source: E.coli

Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

MW: 48.4 kDa

Alternative Name(s): Allergen Lol p Ib Allergen Lol p Va Allergen: Lol p 5a

Relevance:

Reference: "Isolation of cDNA encoding a newly identified major allergenic protein of rye-grass pollen: intracellular targeting to the amyloplast." Singh M.B., Hough T., Theerakulpisut P., Avjioglu A., Davies S., Smith P.M., Taylor P., Simpson R.J., Ward L.D., McCluskey J., Puy R., Knox R.B.Proc. Natl. Acad. Sci. U.S.A. 88:1384-1388(1991)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer，50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.