Skip to product information
1 of 1

Gene Bio Systems

Recombinant Lodderomyces elongisporus Altered inheritance of mitochondria protein 11(AIM11)

Recombinant Lodderomyces elongisporus Altered inheritance of mitochondria protein 11(AIM11)

SKU:CSB-CF399829LLV

Regular price €1.439,95 EUR
Regular price Sale price €1.439,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) (Yeast) (Saccharomyces elongisporus)

Uniprot NO.:A5E5Y6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTSTTRDVLHKLNFSIADASPEYIDRRKLQMAKFFTFAALSIFSTRFIYKQTIARQYVPL LFQQNHQPPTSYNFTADAMVAVGAGTLACGSISGMLMFGTAWILDVSNLKEFGYRMKALM GGDVKEKELSEMKMDDETRALQDGLNDLLEGKI

Protein Names:Recommended name: Altered inheritance of mitochondria protein 11

Gene Names:Name:AIM11 ORF Names:LELG_05025

Expression Region:1-153

Sequence Info:full length protein

View full details