Skip to product information
1 of 1

Gene Bio Systems

Recombinant Leuconostoc gasicomitatum Energy-coupling factor transporter transmembrane protein EcfT(ecfT)

Recombinant Leuconostoc gasicomitatum Energy-coupling factor transporter transmembrane protein EcfT(ecfT)

SKU:CSB-CF518896LPE

Regular price €1.552,95 EUR
Regular price Sale price €1.552,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Leuconostoc gasicomitatum (strain DSM 15947 / CECT 5767 / JCM 12535 / LMG 18811 / TB1-10)

Uniprot NO.:D8MHM9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNNIMIGRFVPGNSWIHRLDPRTKMIVTFVYIIVMLWASNWQTYAWTAAFVVAMVKLTDQ PFKLYWDGLKPIFWLILFTVILQLLFTPGTPILFSVGPFQVTVPGILNAIYVMVRFVLII LMSTILTLTTPPTSIANALESLLSPLKKIGVPVAELALMLAIALRFVPLLMDEMQKIMNA QKSRGMSFSTGGPIKRAKAIIPLLIPLFIGALQRALDLANAMEVRGFKDAVQRTKYRILS YQKIDKVAFAALIGFVIIFFVIKTWLHG

Protein Names:Recommended name: Energy-coupling factor transporter transmembrane protein EcfT Short name= ECF transporter T component EcfT

Gene Names:Name:ecfT Ordered Locus Names:LEGAS_1699

Expression Region:1-268

Sequence Info:full length protein

View full details