Gene Bio Systems
Recombinant Leptosphaeria maculans Signal peptidase complex catalytic subunit SEC11(SEC11)
Recombinant Leptosphaeria maculans Signal peptidase complex catalytic subunit SEC11(SEC11)
SKU:CSB-CF515219LOP
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8) (Blackleg fungus) (Phoma lingam)
Uniprot NO.:E5A8D2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLGVSGMQPRQLAAQILNFALVLSTAFMMWKGLSVVSDSSSPIVVVLSGSMEPAFQRGDL LFLWNRGLDTQVGEIVVYNVKGKDIPIVHRVVRRYGGGKTPLRLLTKGDNNIADDTELYA TSQSFLTRKEDVVGSVVGFIPFVGYVTILLSENPWMKQVMLGLMGVMVVLQRE
Protein Names:Recommended name: Signal peptidase complex catalytic subunit SEC11 EC= 3.4.21.89 Alternative name(s): Signal peptidase I
Gene Names:Name:SEC11 ORF Names:Lema_P074660
Expression Region:1-173
Sequence Info:full length protein
