GeneBio Systems
Recombinant Lepidoglyphus destructor Mite group 2 allergen Lep d 2
Recombinant Lepidoglyphus destructor Mite group 2 allergen Lep d 2
SKU:P80384
Couldn't load pickup availability
Size: 100ug. Other sizes are also available.
Activity: Not tested
Research Areas: Others
Uniprot ID: P80384
Gene Names: N/A
Alternative Name(s): Allergen Lep d 1 Allergen Lep d I Allergen: Lep d 2
Abbreviation: Recombinant Lepidoglyphus destructor Mite group 2 allergen Lep d 2 protein
Organism: Lepidoglyphus destructor (Storage mite) (Glycyphagus destructor)
Source: E.coli
Expression Region: 17-141aa
Protein Length: Full Length of Mature Protein
Tag Info: N-terminal 6xHis-SUMO-tagged
Target Protein Sequence: GKMTFKDCGHGEVTELDITGCSGDTCVIHRGEKMTLEAKFAANQDTAKVTIKVLAKVAGTTIQVPGLETDGCKFIKCPVKKGEALDFIYSGTIPAITPKVKADVTAELIGDHGVMACGTVHGQVE
MW: 29.1 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Endotoxin: Not test
Biological_Activity:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Relevance:
Reference: "cDNA analysis of the mite allergen Lep d 1 identifies two different isoallergens and variants."Schmidt M., van der Ploeg I., Olsson S., van Hage-Hamsten M.FEBS Lett. 370: 11-14(1995)
Function:
