Skip to product information
1 of 1

Gene Bio Systems

Recombinant Legionella pneumophila subsp. pneumophila UPF0391 membrane protein lpg2415(lpg2415)

Recombinant Legionella pneumophila subsp. pneumophila UPF0391 membrane protein lpg2415(lpg2415)

SKU:CSB-CF720055LDL

Regular price €1.348,95 EUR
Regular price Sale price €1.348,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)

Uniprot NO.:Q5ZSV1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLYWALIFLIVAIVAGLFGFRGVASAATGIAKVLFFLFIVMFIVLLVFSLLGGTPEPVVI VKP

Protein Names:Recommended name: UPF0391 membrane protein lpg2415

Gene Names:Ordered Locus Names:lpg2415

Expression Region:1-63

Sequence Info:full length protein

View full details