Skip to product information
1 of 1

Gene Bio Systems

Recombinant Lactococcus phage r1t Holin

Recombinant Lactococcus phage r1t Holin

SKU:CSB-CF655018LBAG

Regular price €1.355,95 EUR
Regular price Sale price €1.355,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Lactococcus phage r1t (Bacteriophage r1t)

Uniprot NO.:Q38134

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKTFFKDMAERAIKTFAQAMIGALGAGATGLIGVDWLQALSIAGFATVVSILTSLASGIP GDNTASLVNNKKEGE

Protein Names:Recommended name: Holin

Gene Names:

Expression Region:1-75

Sequence Info:full length protein

View full details