Gene Bio Systems
Recombinant Lactococcus phage r1t Holin
Recombinant Lactococcus phage r1t Holin
SKU:CSB-CF655018LBAG
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Lactococcus phage r1t (Bacteriophage r1t)
Uniprot NO.:Q38134
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MKTFFKDMAERAIKTFAQAMIGALGAGATGLIGVDWLQALSIAGFATVVSILTSLASGIP GDNTASLVNNKKEGE
Protein Names:Recommended name: Holin
Gene Names:
Expression Region:1-75
Sequence Info:full length protein
