Skip to product information
1 of 1

Gene Bio Systems

Recombinant Lactobacillus delbrueckii subsp. bulgaricus UPF0397 protein Ldb1710(Ldb1710)

Recombinant Lactobacillus delbrueckii subsp. bulgaricus UPF0397 protein Ldb1710(Ldb1710)

SKU:CSB-CF627349LAQ

Regular price €1.469,95 EUR
Regular price Sale price €1.469,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081)

Uniprot NO.:Q1G8W8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNKDMWKLSPKNIAALGIGSAVFVIVGRFASIPSGLPNTNFELVYAFLAMIAMIYGPTVG FGVGFIGHVLLDLMMYGQTWWNWNFAAGFLGFFIGLYALRVNIDQGEFSAKEMVIFNVVQ VVANAIVWFLLGSVGDMVLNSEPAAKVFAQAGLTTLMDGLTIAVLGTILLKLYAGSRVKK GSLHKD

Protein Names:Recommended name: UPF0397 protein Ldb1710

Gene Names:Ordered Locus Names:Ldb1710

Expression Region:1-186

Sequence Info:full length protein

View full details