Skip to product information
1 of 1

Gene Bio Systems

Recombinant Lactobacillus casei UPF0397 protein LCABL_04350 (LCABL_04350)

Recombinant Lactobacillus casei UPF0397 protein LCABL_04350 (LCABL_04350)

SKU:CSB-CF459478LMJ

Regular price €1.469,95 EUR
Regular price Sale price €1.469,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Lactobacillus casei (strain BL23)

Uniprot NO.:B3W705

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MRDQKALSVRTVVAIGIGTAILFILKRFAVIPTGIANTNIDISYGFLGFIATLFGPIAGF FIGFLGHALNDFTQYGTPWWTWVFTTGLVGMVIGLFWRRFNVEAGNFGMKKIVSFNLLQI ITNVVSWSLIAPTLDIWIYSEPANKVYVQGIVSAISNSIATGVIGTILLVTYAATRTRSG SLKKES

Protein Names:Recommended name: UPF0397 protein LCABL_04350

Gene Names:Ordered Locus Names:LCABL_04350

Expression Region:1-186

Sequence Info:full length protein

View full details