Gene Bio Systems
Recombinant Lactobacillus casei Large-conductance mechanosensitive channel(mscL)
Recombinant Lactobacillus casei Large-conductance mechanosensitive channel(mscL)
SKU:CSB-CF461423LMJ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Lactobacillus casei (strain BL23)
Uniprot NO.:B3WAS8
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLKEFQKFIMRGNVLDLAVGVIIGSAFTGLVTSLTKNLINPILSMFAGKADLSGLYFTIL GAKFTYGNFINDVLNFLIIAFVVFLLVKGINRILPSKPAKPAGPTQEELLTEIRDLLKQD QQV
Protein Names:Recommended name: Large-conductance mechanosensitive channel
Gene Names:Name:mscL Ordered Locus Names:LCABL_27460
Expression Region:1-123
Sequence Info:full length protein