
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Lactobacillus brevis (strain ATCC 367 / JCM 1170)
Uniprot NO.:Q03SF6
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLKEFKEFIARGNVMDLAVGVIVGAAFTAIVNSLVTNIINPLLGIFVGSIDFSNLVFTVG SAHFRYGAFINSVINFLIIAFVVFLLIKLINKLIAKPAEEPEEAVPSQEEKYLQEIVELL KQDKIEH
Protein Names:Recommended name: Large-conductance mechanosensitive channel
Gene Names:Name:mscL Ordered Locus Names:LVIS_0723
Expression Region:1-127
Sequence Info:full length protein
You may also like
-
Recombinant Brevibacillus brevis Large-conductance mechanosensitive channel(mscL)
- Regular price
- €1.052,95 EUR
- Sale price
- €1.052,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Lactobacillus fermentum Large-conductance mechanosensitive channel(mscL)
- Regular price
- €1.030,95 EUR
- Sale price
- €1.030,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Lactobacillus gasseri Large-conductance mechanosensitive channel(mscL)
- Regular price
- €1.030,95 EUR
- Sale price
- €1.030,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Lactobacillus sakei subsp. sakei Large-conductance mechanosensitive channel(mscL)
- Regular price
- €1.035,95 EUR
- Sale price
- €1.035,95 EUR
- Regular price
-
- Unit price
- per
Sold out