Skip to product information
1 of 1

Gene Bio Systems

Recombinant Kluyveromyces lactis UPF0495 protein KLLA0D04334g(KLLA0D04334g)

Recombinant Kluyveromyces lactis UPF0495 protein KLLA0D04334g(KLLA0D04334g)

SKU:CSB-CF732062KBK

Regular price €1.357,95 EUR
Regular price Sale price €1.357,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica)

Uniprot NO.:Q6CS34

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MRPTQFVLNAAKKKSGFSVPVELTPLFLAMGVALASGTWFSYKKFFHDDSLRVSRKNPEQ SALDKVLNQKAE

Protein Names:Recommended name: UPF0495 protein KLLA0D04334g

Gene Names:Ordered Locus Names:KLLA0D04334g

Expression Region:1-72

Sequence Info:full length protein

View full details