Gene Bio Systems
Recombinant Klebsiella pneumoniae subsp. pneumoniae Probable oxaloacetate decarboxylase gamma chain(oadG)
Recombinant Klebsiella pneumoniae subsp. pneumoniae Probable oxaloacetate decarboxylase gamma chain(oadG)
SKU:CSB-CF412520KAX
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Uniprot NO.:A6T4H1
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTDNAILLGEGFTLMFLGMGFVLVFLLLLIFAIRGMSLAVNRLFSEPPAAPKPAPAAVAP ADDFARLKPAIVAAIHHHRRLHP
Protein Names:Recommended name: Probable oxaloacetate decarboxylase gamma chain EC= 4.1.1.3
Gene Names:Name:oadG Ordered Locus Names:KPN78578_00310 ORF Names:KPN_00032
Expression Region:1-83
Sequence Info:full length protein
