Skip to product information
1 of 1

Gene Bio Systems

Recombinant Julidochromis regani Cytochrome b(mt-cyb)

Recombinant Julidochromis regani Cytochrome b(mt-cyb)

SKU:CSB-CF015075JAL

Regular price €1.360,95 EUR
Regular price Sale price €1.360,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Julidochromis regani (Convict julie)

Uniprot NO.:P16367

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:TALFLAMHYTSDIATAFSSVAHICRDVNYGWLIRNMHANGASFLFICIYLHIGRGLYYGS YLYKETWNIGVILLLLTMM

Protein Names:Recommended name: Cytochrome b Alternative name(s): Complex III subunit 3 Complex III subunit III Cytochrome b-c1 complex subunit 3 Ubiquinol-cytochrome-c reductase complex cytochrome b subunit

Gene Names:Name:mt-cyb Synonyms:cob, cytb, mtcyb

Expression Region:1-79

Sequence Info:full length protein

View full details