Skip to product information
1 of 1

Gene Bio Systems

Recombinant Ixodes scapularis UPF0608 protein ISCW013552 (ISCW013552)

Recombinant Ixodes scapularis UPF0608 protein ISCW013552 (ISCW013552)

SKU:CSB-CF488115INM

Regular price €1.356,95 EUR
Regular price Sale price €1.356,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Ixodes scapularis (Black-legged tick) (Deer tick)

Uniprot NO.:B7QIN3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MISDIILFGTLMVNAGAVLNFKLQKTPSESFVEKTEPTAGDKIRDFLGAVRYFRAFIGLW NIFIMFLMLVFFGS

Protein Names:Recommended name: UPF0608 protein ISCW013552

Gene Names:ORF Names:ISCW013552

Expression Region:1-74

Sequence Info:full length protein

View full details