Skip to product information
1 of 1

Gene Bio Systems

Recombinant Invertebrate iridescent virus 3 Transmembrane protein 022L(IIV3-022L)

Recombinant Invertebrate iridescent virus 3 Transmembrane protein 022L(IIV3-022L)

SKU:CSB-CF613920IAAL

Regular price €1.503,95 EUR
Regular price Sale price €1.503,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Invertebrate iridescent virus 3 (IIV-3) (Mosquito iridescent virus)

Uniprot NO.:Q197D8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSFVHKLPTFYTAGVGAIIGGLSLRFNGAKFLSDWYINKYNDSVPAWSLQTCHWAGIALY CVGWVTLASVIYLKHRDNSILKGSILSCIVISAVWSILEYNQDMFVSNPKLPLISCAMLV SSLAALVALKYHIKDIFTILGAAIIIILAEYVVLPYQRQYNIVDGIGLPLLLLGFFILYQ VFSVPNPSTPTGVMVPKPEDEWDIEMAPLNHRDRQVPESELENVK

Protein Names:Recommended name: Transmembrane protein 022L

Gene Names:ORF Names:IIV3-022L

Expression Region:1-225

Sequence Info:full length protein

View full details