Skip to product information
1 of 1

Gene Bio Systems

Recombinant Influenza B virus Glycoprotein NB(NB)

Recombinant Influenza B virus Glycoprotein NB(NB)

SKU:CSB-CF303694IJL

Regular price €1.380,95 EUR
Regular price Sale price €1.380,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Influenza B virus (strain B/Leningrad/179/1986)

Uniprot NO.:P67908

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNNATFNYTNVNPISHIRGSVIITICVSFTVILTVFGYIAKIFTKNNCTNNDIGLRERIK CSGCEPFCNKRDDISSPRTGVDIPSFILPGLNLSESTPN

Protein Names:Recommended name: Glycoprotein NB

Gene Names:Name:NB

Expression Region:1-99

Sequence Info:full length protein

View full details