Recombinant Ignicoccus hospitalis Major outer membrane protein 1(ihomp1)

SKU: CSB-CF419669ILH

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125)

Uniprot NO.:A8ABZ0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:GIGYTAVIALAALVLVMGALGLVLKVAAAAGALPSEVAKVANALPGLKASVDANPAAGSL SSVSVST

Protein Names:Recommended name: Major outer membrane protein 1 Short name= Ihomp1 Alternative name(s): Outer membrane protein Imp1227

Gene Names:Name:ihomp1 Synonyms:imp1227 Ordered Locus Names:Igni_1266

Expression Region:19-85

Sequence Info:full length protein