Gene Bio Systems
Recombinant Idiomarina loihiensis UPF0060 membrane protein IL1642(IL1642)
Recombinant Idiomarina loihiensis UPF0060 membrane protein IL1642(IL1642)
SKU:CSB-CF712752IAAA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Uniprot NO.:Q5QUB1
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSALFLMKTLGLFIATAIAEIVGCYLPYLWLKEGHSVWLLIPAAVSLALFAYLLTLHPAE SGRVYAAYGGIYVLTAIVWLRIVDKSPLSNFDLIGTAFVLTGMGILVYGWR
Protein Names:Recommended name: UPF0060 membrane protein IL1642
Gene Names:Ordered Locus Names:IL1642
Expression Region:1-111
Sequence Info:full length protein
