Gene Bio Systems
Recombinant Hyperthermus butylicus UPF0290 protein Hbut_1639 (Hbut_1639)
Recombinant Hyperthermus butylicus UPF0290 protein Hbut_1639 (Hbut_1639)
SKU:CSB-CF382402HSR
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Hyperthermus butylicus (strain DSM 5456 / JCM 9403)
Uniprot NO.:A2BN92
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAQLLTPLESILAIIPALAANGAPVLLKYHGTPIDGGKRFLDGRPVLGPGKTWEGLATGI LYGSVIALLAASATCNPKLYAAGVFASIGAMLGDMLGAFIKRRLGLERGAPAPLLDQLDF YSGALLALYAAGYVVHPAVALTFTPIVIALHRLTNMAANRLRLKPVPW
Protein Names:Recommended name: UPF0290 protein Hbut_1639
Gene Names:Ordered Locus Names:Hbut_1639
Expression Region:1-168
Sequence Info:full length protein
