Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Visinin-like protein 1(VSNL1)

Recombinant Human Visinin-like protein 1(VSNL1)

SKU:CSB-EP025933HU

Regular price €605,95 EUR
Regular price Sale price €605,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Signal Transduction

Uniprot ID: P62760

Gene Names: VSNL1

Organism: Homo sapiens (Human)

AA Sequence: GKQNSKLAPEVMEDLVKSTEFNEHELKQWYKGFLKDCPSGRLNLEEFQQLYVKFFPYGDASKFAQHAFRTFDKNGDGTIDFREFICALSITSRGSFEQKLNWAFNMYDLDGDGKITRVEMLEIIEAIYKMVGTVIMMKMNEDGLTPEQRVDKIFSKMDKNKDDQITLDEFKEAAKSDPSIVLLLQCDIQK

Expression Region: 1-191aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 49 kDa

Alternative Name(s): Hippocalcin-like protein 3

Relevance: Regulates the inhibition of rhodopsin phosphorylation in a calcium-dependent manner.

Reference: "Peptide conservation between avian and mammalian visinin-like proteins." Bellingham J. Submitted (DEC-1997)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details