Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Vesicle transport protein SFT2A(SFT2D1)

Recombinant Human Vesicle transport protein SFT2A(SFT2D1)

SKU:CSB-CF837854HU

Regular price €1.433,95 EUR
Regular price Sale price €1.433,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q8WV19

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEKLRRVLSGQDDEEQGLTAQVLDASSLSFNTRLKWFAICFVCGVFFSILGTGLLWLPGG IKLFAVFYTLGNLAALASTCFLMGPVKQLKKMFEATRLLATIVMLLCFIFTLCAALWWHK KGLAVLFCILQFLSMTWYSLSYIPYARDAVIKCCSSLLS

Protein Names:Recommended name: Vesicle transport protein SFT2A Alternative name(s): SFT2 domain-containing protein 1 pRGR1

Gene Names:Name:SFT2D1 Synonyms:C6orf83

Expression Region:1-159

Sequence Info:full length protein

View full details