Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Vasohibin-2(VASH2)

Recombinant Human Vasohibin-2(VASH2)

SKU:CSB-EP769783HU

Regular price €869,95 EUR
Regular price Sale price €869,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Cardiovascular

Uniprot ID: Q86V25

Gene Names: VASH2

Organism: Homo sapiens (Human)

AA Sequence: MTGSAADTHRCPHPKGAKGTRSRSSHARPVSLATSGGSEEEDKDGGVLFHVNKSGFPIDSHTWERMWMHVAKVHPKGGEMVGAIRNAAFLAKPSIPQVPNYRLSMTIPDWLQAIQNYMKTLQYNHTGTQFFEIRKMRPLSGLMETAKEMTRESLPIKCLEAVILGIYLTNGQPSIERFPISFKTYFSGNYFHHVVLGIYCNGRYGSLGMSRRAELMDKPLTFRTLSDLIFDFEDSYKKYLHTVKKVKIGLYVPHEPHSFQPIEWKQLVLNVSKMLRADIRKELEKYARDMRMKILKPASAHSPTQVRSRGKSLSPRRRQASPPRRLGRREKSPALPEKKVADLSTLNEVGYQIRI

Expression Region: 1-355aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 56.4 kDa

Alternative Name(s): Vasohibin-like protein

Relevance: Angiogenesis inhibitor. Inhibits network formation by endothelial cells.

Reference: "Isolation and characterization of vasohibin-2 as a homologue of VEGF-inducible endothelium-derived angiogenesis inhibitor vasohibin." Shibuya T., Watanabe K., Yamashita H., Shimizu K., Miyashita H., Abe M., Moriya T., Ohta H., Sonoda H., Shimosegawa T., Tabayashi K., Sato Y.Arterioscler. Thromb. Vasc. Biol. 26:1051-1057(2006)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details