
Size:100ug. Other sizes are also available. For further information, please contact us.
Research Areas:Cell Biology
Uniprot ID:P07478
Gene Names:PRSS2
Organism:Homo sapiens (Human)
AA Sequence:APFDDDDQIVGGYICEENSVPYQVSLNSGYHFCGGSLISEQWVVSAGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPKYNSRTLDNDILLIKLSSPAVINSRVSAISLPTAPPAAGTESLISGWGNTLSSGADYPDELQCLDAPVLGQAECEASYPGKITNNMFCVGFLEGGKDSCQGDSGGPVVSNGELQGIVSWGYGCAQKNRPGVYTKVYNYVDWIKDTIAANS
Expression Region:16-247aa(K23Q,S167G)
Sequence Info:Partial
Source:E.coli
Tag Info:N-terminal GST-tagged
MW:52.4 kDa
Alternative Name(s):Trypsin-2(EC 3.4.21.4)(Anionic trypsinogen)(Serine protease 2)(Trypsin II)
Relevance:In the ileum, may be involved in defensin processing, including DEFA5.
Reference:"Paneth cell trypsin is the processing enzyme for human defensin-5." Ghosh D., Porter E., Shen B., Lee S.K., Wilk D., Drazba J., Yadav S.P., Crabb J.W., Ganz T., Bevins C.L. Nat. Immunol. 3:583-590(2002)
Purity:Greater than 90% as determined by SDS-PAGE.
Form:Liquid or Lyophilized powder
Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
HGNC Database Link:
UniGene Database Link:
KEGG Database Link:
STRING Database Link:
OMIM Database Link:
Lead Time Guidance:13-23 business days
You may also like
-
Recombinant Human Trypsin-2(PRSS2)
- Regular price
- €444,95 EUR
- Sale price
- €444,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Brain-specific serine protease 4(Prss22)
- Regular price
- €586,95 EUR
- Sale price
- €586,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Trypsin-1(PRSS1)
- Regular price
- €444,95 EUR
- Sale price
- €444,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Muscle, skeletal receptor tyrosine-protein kinase(MUSK),partial (Active)
- Regular price
- €746,95 EUR
- Sale price
- €746,95 EUR
- Regular price
-
- Unit price
- per
Sold out