Gene Bio Systems
Recombinant Human Trefoil factor 3(TFF3),partial
Recombinant Human Trefoil factor 3(TFF3),partial
SKU:CSB-YP023433HU
Couldn't load pickup availability
Size:20ug. Other sizes are also available. For further information, please contact us.
Research Areas:Signal Transduction
Uniprot ID:Q07654
Gene Names:TFF3
Organism:Homo sapiens (Human)
AA Sequence:LLSSSSAEEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGV
Expression Region:29-80aa
Sequence Info:Partial
Source:Yeast
Tag Info:N-terminal 6xHis-tagged
MW:7.5 kDa
Alternative Name(s):Intestinal trefoil factor (hITF) (Polypeptide P1.B) (hP1.B) (ITF) (TFI)
Relevance:Involved in the maintenance and repair of the intestinal mucosa. Promotes the mobility of epithelial cells in healing processes (motogen).
Reference:"The three human trefoil genes TFF1, TFF2, and TFF3 are located within a region of 55 kb on chromosome 21q22.3." Seib T., Blin N., Hilgert K., Seifert M., Theisinger B., Engel M., Dooley S., Zang K.D., Welter C. Genomics 40:200-202(1997)
Purity:Greater than 90% as determined by SDS-PAGE.
Form:Liquid or Lyophilized powder
Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:Involved in the maintenance and repair of the intestinal mucosa. Promotes the mobility of epithelial cells in healing processes (motogen).
Involvement in disease:
Subcellular Location:Secreted, extracellular space, extracellular matrix, Cytoplasm
Protein Families:
Tissue Specificity:Expressed in goblet cells of the intestines and colon (at protein level). Expressed by goblet cells of small and large intestinal epithelia and also by the uterus. Also expressed in the hypothalamus where it is detected in paraventricular, periventricular and supraoptic nuclei (at protein level).
Paythway:
HGNC Database Link:https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=HGNC:11757
UniGene Database Link:https://www.ncbi.nlm.nih.gov/UniGene/clust.cgi?ORG=Hs&CID=82961
KEGG Database Link:https://www.genome.jp/dbget-bin/www_bget?hsa:7033
STRING Database Link:https://string-db.org/network/9606.ENSP00000430690
OMIM Database Link:https://www.omim.org/entry/600633600633600633
Lead Time Guidance:3-7 business days
