Recombinant Human  Transmembrane protein C19orf77(C19orf77)

Recombinant Human Transmembrane protein C19orf77(C19orf77)

CSB-CF526763HU
Regular price
€1.010,95 EUR
Sale price
€1.010,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:O75264

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:QQATEHRLKPWLVGLAAVVGFLFIVYLVLLANRLWCSKARAEDEEETTFRMESNLYQDQS EDKREKKEAKEKEEKRKKEKKTAKEGESNLGLDLEEKEPGDHERAKSTVM

Protein Names:Recommended name: Transmembrane protein C19orf77

Gene Names:Name:C19orf77 ORF Names:HSPC323

Expression Region:21-130

Sequence Info:full length protein

Your list is ready to share