Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Transmembrane protein 207(TMEM207)

Recombinant Human Transmembrane protein 207(TMEM207)

SKU:CSB-CF023801HU

Regular price €1.398,95 EUR
Regular price Sale price €1.398,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q6UWW9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:DLPCEEDEMCVNYNDQHPNGWYIWILLLLVLVAALLCGAVVLCLQCWLRRPRIDSHRRTM AVFAVGDLDSIYGTEAAVSPTVGIHLQTQTPDLYPVPAPCFGPLGSPPPYEEIVKTT

Protein Names:Recommended name: Transmembrane protein 207

Gene Names:Name:TMEM207 ORF Names:UNQ846/PRO1784

Expression Region:30-146

Sequence Info:full length protein

View full details