Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Transmembrane 4 L6 family member 1(TM4SF1),partial

Recombinant Human Transmembrane 4 L6 family member 1(TM4SF1),partial

SKU:CSB-YP023615HU1

Regular price €991,95 EUR
Regular price Sale price €991,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Cancer

Uniprot ID: P30408

Gene Names: TM4SF1

Organism: Homo sapiens (Human)

AA Sequence: LAEGPLCLDSLGQWNYTFASTEGQYLLDTSTWSECTEPKHIVEWNVS

Expression Region: 115-161aa

Sequence Info: Extracellular Domain

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 7.3 kDa

Alternative Name(s): Membrane component chromosome 3 surface marker 1 Tumor-associated antigen L6

Relevance:

Reference: "Cloning and expression of the tumor-associated antigen L6."Marken J.S., Schieven G.L., Hellstroem I., Hellstroem K.E., Aruffo A.Proc. Natl. Acad. Sci. U.S.A. 89:3503-3507(1992)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details