Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Transcription factor BTF3(BTF3),partial

Recombinant Human Transcription factor BTF3(BTF3),partial

SKU:CSB-RP017144h

Regular price €610,95 EUR
Regular price Sale price €610,95 EUR
Sale Sold out
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Transcription

Uniprot ID: P20290

Gene Names: BTF3

Organism: Homo sapiens (Human)

AA Sequence: TIMNQEKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQFSLKKLGVNNISGIEEVNMFTNQGTVIHFNNPKVQASLAANTFTITGHAETKQLTEMLPSILNQLGADSLTSLRRLAEALPKQSVDGKAPLATGEDDDDEVPDLVENFDEASKNEAN

Expression Region: 48-206aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 44.3 kDa

Alternative Name(s): Nascent polypeptide-associated complex subunit beta ;NAC-betaRNA polymerase B transcription factor 3

Relevance: When associated with NACA, prevents inappropriate targeting of non-secretory polypeptides to the endoplasmic reticulum (ER). Binds to nascent polypeptide chains as they erge from the ribosome and blocks their interaction with the signal recognition particle (SRP), which normally targets nascent secretory peptides to the ER. BTF3 is also a general transcription factor that can form a stable complex with RNA polymerase II. Required for the initiation of transcription.

Reference: Sequencing and expression of complementary DNA for the general transcription factor BTF3.Zheng X.M., Black D., Chambon P., Egly J.-M.Nature 344:556-559(1990)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)