
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Immunology
Uniprot ID: Q15369
Gene Names: TCEB1
Organism: Homo sapiens (Human)
AA Sequence: MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC
Expression Region: 1-112aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal GST-tagged
MW: 39.5 kDa
Alternative Name(s): Elongin 15KDA subunitElongin-C ;EloCRNA polymerase II transcription factor SIII subunit CSIII p15
Relevance: SIII, also known as elongin, is a general transcription elongation factor that increases the RNA polymerase II transcription elongation past tplate-encoded arresting sites. Subunit A is transcriptionally active and its transcription activity is strongly enhanced by binding to the dimeric complex of the SIII regulatory subunits B and C (elongin BC complex).
Reference: Structure of the SOCS4-ElonginB/C complex reveals a distinct SOCS box interface and the molecular basis for SOCS-dependent EGFR degradation.Bullock A.N., Rodriguez M.C., Debreczeni J.E., Songyang Z., Knapp S.Structure 15:1493-1504(2007)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Human Transcription elongation factor B polypeptide 2(TCEB2)
- Regular price
- €499,95 EUR
- Sale price
- €499,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Negative elongation factor B(NELFB),partial
- Regular price
- €499,95 EUR
- Sale price
- €499,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human TCEB2
- Regular price
- €400,95 EUR
- Sale price
- €400,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Transcription initiation factor IIE subunit beta(GTF2E2)
- Regular price
- €499,95 EUR
- Sale price
- €499,95 EUR
- Regular price
-
- Unit price
- per
Sold out