Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human TM2 domain-containing protein 1(TM2D1)

Recombinant Human TM2 domain-containing protein 1(TM2D1)

SKU:CSB-CF887145HU

Regular price €1.452,95 EUR
Regular price Sale price €1.452,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q9BX74

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:TSAGGEESLKCEDLKVGQYICKDPKINDATQEPVNCTNYTAHVSCFPAPNITCKDSSGNE THFTGNEVGFFKPISCRNVNGYSYKVAVALSLFLGWLGADRFYLGYPALGLLKFCTVGFC GIGSLIDFILISMQIVGPSDGSSYIIDYYGTRLTRLSITNETFRKTQLYP

Protein Names:Recommended name: TM2 domain-containing protein 1 Alternative name(s): Beta-amyloid-binding protein Short name= hBBP

Gene Names:Name:TM2D1 Synonyms:BBP

Expression Region:38-207

Sequence Info:full length protein

View full details