Recombinant Human TGFB1-induced anti-apoptotic factor 1(TIAF1)

Recombinant Human TGFB1-induced anti-apoptotic factor 1(TIAF1)

CSB-EP023528HU
Regular price
€491,95 EUR
Sale price
€491,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Cell Biology

Uniprot ID: O95411

Gene Names: TIAF1

Organism: Homo sapiens (Human)

AA Sequence: MSSPSSPFREQSFLCAAGDAGEESRVQVLKNEVRRGSPVLLGWVEQAYADKCVCGPSAPPAPTPPSLSQRVMCNDLFKVNPFQLQQFRADPSTASLLLCPGGLDHKLNLRGKAWG

Expression Region: 1-115aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 39.4 kDa

Alternative Name(s): 12KDA TGF-beta-1-induced antiapoptotic factor

Relevance: Inhibits the cytotoxic effects of TNF-alpha and overexpressed TNF receptor adapters TRADD, FADD, and RIPK1. Involved in TGF-beta1 inhibition of IkappaB-alpha expression and suppression of TNF-mediated IkappaB-alpha degradation.

Reference: "High expression of TIAF-1 in chronic kidney and liver allograft rejection and in activated T-helper cells." van der Leij J., van den Berg A., Albrecht E.W., Blokzijl T., Roozendaal R., Gouw A.S., de Jong K.P., Stegeman C.A., van Goor H., Chang N.S., Poppema S. Transplantation 75:2076-2082(2003)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share