Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Tenascin(TNC),partial

Recombinant Human Tenascin(TNC),partial

SKU:CSB-RP115094h(C)

Regular price €676,95 EUR
Regular price Sale price €676,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Signal Transduction

Uniprot ID: P24821

Gene Names: TNC

Organism: Homo sapiens (Human)

AA Sequence: DSPRDLTATEVQSETALLTWRPPRASVTGYLLVYESVDGTVKEVIVGPDTTSYSLADLSPSTHYTAKIQALNGPLRSNMIQTIFTTIGLLYPFPKDCSQAMLNGDTTSGLYTIYLNGDKAEALEVFCDMTSDGGGWIVFLRRKNGRENFYQNWKAYAAGFGDRREEFWLGLDNLNKITAQGQYELRVDLRDHGETAFAVYDKFSVGDAKTRYKLKVEGYSGTAGDSMAYHNGRSFSTFDKDTDSAITNCALSYKGAFWYRNCHRVNLMGRYGDNNHSQGVNWFHWKGHEHSIQFAEMKLRPSNFRNLEGRRKRA

Expression Region: 1888-2201aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 39.5 kDa

Alternative Name(s): Cytotactin;GMEMGP 150-225Glioma-associated-Extracellular domain matrix antigenHexabrachionJIMyotendinous antigenNeuronectin;Tenascin-C ;TN-C

Relevance: Extracellular domain matrix protein implicated in guidance of migrating neurons as well as axons during development, synaptic plasticity as well as neuronal regeneration. Promotes neurite outgrowth from cortical neurons grown on a monolayer of astrocytes. Ligand for integrins alpha-8/beta-1, alpha-9/beta-1, alpha-V/beta-3 and alpha-V/beta-6.

Reference: An alternatively spliced region of the human hexabrachion contains a repeat of potential N-glycosylation sites.Gulcher J.R., Nies D.E., Marton L.S., Stefansson K.Proc. Natl. Acad. Sci. U.S.A. 86:1588-1592(1989)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details