Gene Bio Systems
Recombinant Human Tail-anchored protein insertion receptor WRB(WRB)
Recombinant Human Tail-anchored protein insertion receptor WRB(WRB)
SKU:CSB-CF026148HU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Homo sapiens (Human)
Uniprot NO.:O00258
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSSAAADHWAWLLVLSFVFGCNVLRILLPSFSSFMSRVLQKDAEQESQMRAEIQDMKQEL STVNMMDEFARYARLERKINKMTDKLKTHVKARTAQLAKIKWVISVAFYVLQAALMISLI WKYYSVPVAVVPSKWITPLDRLVAFPTRVAGGVGITCWILVCNKVVAIVLHPFS
Protein Names:Recommended name: Tail-anchored protein insertion receptor WRB Alternative name(s): Congenital heart disease 5 protein Tryptophan-rich basic protein Short name= WRB
Gene Names:Name:WRB Synonyms:CHD5
Expression Region:1-174
Sequence Info:Full length protein
