Recombinant Human T-cell surface glycoprotein CD3 epsilon chain(CD3E)

Recombinant Human T-cell surface glycoprotein CD3 epsilon chain(CD3E)

CSB-RP104844h
Regular price
€491,95 EUR
Sale price
€491,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170725

Research areas: Immunology

Target / Protein: CD3E

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Homo sapiens (Human)

Delivery time: 3-7 business days

Uniprot ID: P07766

AA Sequence: DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI

Tag info: N-terminal GST-tagged

Expression Region: 23-207aa

Protein length: Full Length of Mature Protein

MW: 47.7 kDa

Alternative Name(s): T-cell surface antigen T3/Leu-4 epsilon chain; CD3e

Relevance: The CD3 complex mediates signal transduction.

Reference: Isolation of cDNA clones encoding the 20K non-glycosylated polypeptide chain of the human T-cell receptor/T3 complex.Gold D.P., Puck J.M., Pettey C.L., Cho M., Coligan J., Woody J.N., Terhorst C.Nature 321:431-434(1986)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share