Skip to product information
1 of 1

Gene Bio Systems

Recombinant Human Syndecan-2(SDC2)

Recombinant Human Syndecan-2(SDC2)

SKU:CSB-CF020889HU

Regular price €1.461,95 EUR
Regular price Sale price €1.461,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:P34741

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:ESRAELTSDKDMYLDNSSIEEASGVYPIDDDDYASASGSGADEDVESPELTTSRPLPKILLTSAAPKVETTTLNIQNKIPAQTKSPEETDKEKVHLSDSERKMDPAEEDTNVYTEKHSDSLFKRTEVLAAVIAGGVIGFLFAIFLILLLVYRMRKKDEGSYDLGERKPSSAAYQKAPTKEFYA

Protein Names:Recommended name: Syndecan-2 Short name= SYND2 Alternative name(s): Fibroglycan Heparan sulfate proteoglycan core protein Short name= HSPG CD_antigen= CD362

Gene Names:Name:SDC2 Synonyms:HSPG1

Expression Region:19-201

Sequence Info:full length protein

View full details