Recombinant Human Synaptogyrin-1(SYNGR1)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human Synaptogyrin-1(SYNGR1)

CSB-EP023011HU1
Regular price
€782,95 EUR
Sale price
€782,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Neuroscience

Uniprot ID: O43759

Gene Names: SYNGR1

Organism: Homo sapiens (Human)

AA Sequence: MEGGAYGAGKAGGAFDPYTLVRQPHTILRVVSWLFSIVVFGSIVNEGYLNSASEGEEFCIYNRNPNACSYGVAVGVLAFLTCLLYLALDVYFPQISSVKDRKKAVLSDIGVSAFWAFLWFVGFCYLANQWQVSKPKDNPLNEGTDAARAAIAFSFFSIFTWSLTAALAVRRFKDLSFQEEYSTLFPASAQP

Expression Region: 1-191aa

Sequence Info: Full Length of Isoform 1B

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 48 kDa

Alternative Name(s):

Relevance: Involved in the regulation of short-term and long-term synaptic plasticity.

Reference: "Characterization of the human synaptogyrin gene family." Kedra D., Pan H.-Q., Seroussi E., Fransson I., Guilbaud C., Collins J.E., Dunham I., Blennow E., Roe B.A., Piehl F., Dumanski J.P. Hum. Genet. 103:131-141(1998)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Human Hematological and neurological expressed 1 protein(HN1)
    Regular price
    €683,95 EUR
    Sale price
    €683,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Synapsin-1(SYN1),partial
    Regular price
    €683,95 EUR
    Sale price
    €683,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Hematological and neurological expressed 1 protein(HN1)
    Regular price
    €612,95 EUR
    Sale price
    €612,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Synapsin-1(SYN1) ,partial
    Regular price
    €612,95 EUR
    Sale price
    €612,95 EUR
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share